PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr8g101650.1
Common NameMTR_8g101650
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family MYB_related
Protein Properties Length: 281aa    MW: 30850.5 Da    PI: 9.2282
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr8g101650.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding41.43.3e-13106150347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE+  ++ + ++lG+g+W+ I++ + + Rt+ q+ s+ qky
  Medtr8g101650.1 106 PWTEEEHRMFLVGLEKLGKGDWRGISKNFVTSRTPTQVASHAQKY 150
                      8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.8799155IPR017930Myb domain
SuperFamilySSF466897.18E-18100155IPR009057Homeodomain-like
TIGRFAMsTIGR015571.8E-18102153IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.601.2E-11103149IPR009057Homeodomain-like
SMARTSM007176.7E-11103153IPR001005SANT/Myb domain
PfamPF002494.2E-11106150IPR001005SANT/Myb domain
CDDcd001671.42E-9106151No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 281 aa     Download sequence    Send to blast
MGRRKCSHCG KIGHNCRTCT SFTLGGLRLF GVQLSSSSSS SSSSNMIKKS FSMDTFPSPS  60
SPSSSFSSST SLTNIDENHY HKSTSNIAYL SDCFIGPPQE RKKGVPWTEE EHRMFLVGLE  120
KLGKGDWRGI SKNFVTSRTP TQVASHAQKY FLRLATINKK RRSSLFDLVG SKKTNTKDQG  180
YANSVVNLGD KFEDKCKCEV EINDGTTLSY FKQEEEAKSE KQENTNYSTT NWLYDSSNCA  240
AVPNLDLTLS VASPNANKTK LEQNQPSPAG SFLLGPISVT *
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mtr.118480.0leaf| root
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1400630.0BT140063.1 Medicago truncatula clone JCVI-FLMt-13F13 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003630638.10.0MYB-like transcription factor family protein
TrEMBLG7LJK10.0G7LJK1_MEDTR; MYB-like transcription factor family protein
STRINGGLYMA08G03330.14e-83(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF32133271
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G56840.11e-43MYB_related family protein
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]